Lineage for d1bzxe_ (1bzx E:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species North atlantic salmon (Salmo salar) [TaxId:8030] [50520] (6 PDB entries) 
Domain d1bzxe_: 1bzx E: [26010]
Other proteins in same PDB: d1bzxi_
Details for d1bzxe_
PDB Entry: 1bzx (more details), 2.1 Å
PDB Description: the crystal structure of anionic salmon trypsin in complex with bovine pancreatic trypsin inhibitor
SCOP Domain Sequences for d1bzxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzxe_ b.47.1.2 (E:) Trypsin(ogen) {North atlantic salmon (Salmo salar)}
ivggyeckpysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy
SCOP Domain Coordinates for d1bzxe_:
Click to download the PDB-style file with coordinates for d1bzxe_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bzxe_:
- d1bzxe_ appears in SCOP 1.57
- d1bzxe_ appears in the current release, SCOPe 2.08
View in 3D
