Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (2 proteins) interrupted by a large insertion, domain N |
Protein Calcium ATPase, catalytic domain P [81655] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (39 PDB entries) Uniprot P04191 |
Domain d4uu0a3: 4uu0 A:344-360,A:600-750 [260093] Other proteins in same PDB: d4uu0a1, d4uu0a2, d4uu0a4 automated match to d1wpga2 complexed with gol, k, mg, so4, tbu, tg1 |
PDB Entry: 4uu0 (more details), 2.5 Å
SCOPe Domain Sequences for d4uu0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uu0a3 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg
Timeline for d4uu0a3: