Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d4mx7a2: 4mx7 A:186-279 [259820] Other proteins in same PDB: d4mx7a1, d4mx7b_ automated match to d3hujc2 complexed with mx7, nag |
PDB Entry: 4mx7 (more details), 2.24 Å
SCOPe Domain Sequences for d4mx7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mx7a2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssadghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
Timeline for d4mx7a2: