SCOP 1.75: Domain d1qqua_: 1qqu A:

Lineage for d1qqua_ (1qqu A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50517] (23 PDB entries)
   Uniprot P00761 9-231
   Uniprot P00761
   Uniprot P00761 9-231 ! Uniprot P00761

8. Domain d1qqua_: 1qqu A: [25963]
   complexed with act, ca

Details for d1qqua_

PDB Entry: 1qqu, 1.63 Å

PDB Description: crystal structure of porcine beta trypsin with bound acetate ion

PDB Compounds: (A:) beta trypsin

SCOP Domain Sequences for d1qqua_:

Sequence; same for both SEQRES and ATOM records:

>d1qqua_ b.47.1.2 (A:) Trypsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
wgntkssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggp
vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan

Timeline for d1qqua_:

• d1qqua_ first appeared (with stable ids) in SCOP 1.55
  
• d1qqua_ appears in SCOP 1.73
  
• d1qqua_ appears in SCOPe 2.01
  
• d1qqua_ appears in the current release, SCOPe 2.08