Lineage for d1qqua_ (1qqu A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) - Species Pig (Sus scrofa) [TaxId:9823] [50517] (13 PDB entries)
Domain d1qqua_: 1qqu A: [25963]
Details for d1qqua_
PDB Entry: 1qqu (more details), 1.63 Å
PDB Description: crystal structure of porcine beta trypsin with bound acetate ion
SCOP Domain Sequences for d1qqua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qqua_ b.47.1.2 (A:) Trypsin(ogen) {Pig (Sus scrofa)}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
wgntkssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggp
vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
SCOP Domain Coordinates for d1qqua_:
Click to download the PDB-style file with coordinates for d1qqua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qqua_:
- d1qqua_ appears in SCOP 1.57
- d1qqua_ appears in the current release, SCOPe 2.08
View in 3D