Lineage for d1d6ra_ (1d6r A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298675Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 298676Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 298774Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins)
  6. 299320Protein Trypsin(ogen) [50515] (8 species)
  7. 299321Species Cow (Bos taurus) [TaxId:9913] [50516] (160 PDB entries)
  8. 299477Domain d1d6ra_: 1d6r A: [25952]
    Other proteins in same PDB: d1d6ri_

Details for d1d6ra_

PDB Entry: 1d6r (more details), 2.3 Å

PDB Description: crystal structure of cancer chemopreventive bowman-birk inhibitor in ternary complex with bovine trypsin at 2.3 a resolution. structural basis of janus-faced serine protease inhibitor specificity

SCOP Domain Sequences for d1d6ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ra_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1d6ra_:

Click to download the PDB-style file with coordinates for d1d6ra_.
(The format of our PDB-style files is described here.)

Timeline for d1d6ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d6ri_