Lineage for d1mtw__ (1mtw -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 230291Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 230292Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 230387Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins)
  6. 230904Protein Trypsin(ogen) [50515] (8 species)
  7. 230905Species Cow (Bos taurus) [TaxId:9913] [50516] (148 PDB entries)
  8. 230982Domain d1mtw__: 1mtw - [25934]
    complexed with ca, dx9

Details for d1mtw__

PDB Entry: 1mtw (more details), 1.9 Å

PDB Description: factor xa specific inhibitor in complex with bovine trypsin

SCOP Domain Sequences for d1mtw__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mtw__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1mtw__:

Click to download the PDB-style file with coordinates for d1mtw__.
(The format of our PDB-style files is described here.)

Timeline for d1mtw__: