Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
Protein automated matches [190781] (45 species) not a true protein |
Species Actinobacillus succinogenes [TaxId:339671] [259290] (1 PDB entry) |
Domain d4r31e_: 4r31 E: [259291] Other proteins in same PDB: d4r31a2 automated match to d2b94a_ complexed with gol |
PDB Entry: 4r31 (more details), 2 Å
SCOPe Domain Sequences for d4r31e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r31e_ c.56.2.0 (E:) automated matches {Actinobacillus succinogenes [TaxId: 339671]} evfhlgltkamlkgakiavipgdparseriaqrmdkpeflassreftswlgylenepvvv cstgiggpsvsicveelaqlgvgtflrigttgaiqpyinvgdvlvttgavrldgasrhfa pleypavadfsctnalysaavaqgitpyvgitassdtfypgqerydtfsgkvypayqgsl kqwqdlnvmnyemesatlftmcaalglkagmvagvivnrtqqeipneatiksteqkavav vieaarrlisa
Timeline for d4r31e_: