Lineage for d4q7je3 (4q7j E:140-282)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552850Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
    beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123
  4. 2552851Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
    comprises two structural repeats of this fold
  5. 2552852Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)
  6. 2552853Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species)
  7. 2552857Species Escherichia coli [TaxId:562] [54716] (6 PDB entries)
    duplication: consists of two subdomains of this fold
  8. 2552881Domain d4q7je3: 4q7j E:140-282 [259274]
    Other proteins in same PDB: d4q7ja1, d4q7jb1, d4q7jb2, d4q7jb3, d4q7je1, d4q7jf1, d4q7jf2, d4q7jf3
    automated match to d1efub2
    protein/RNA complex; complexed with so4

Details for d4q7je3

PDB Entry: 4q7j (more details), 2.9 Å

PDB Description: complex structure of viral rna polymerase
PDB Compounds: (E:) elongation factor ts

SCOPe Domain Sequences for d4q7je3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q7je3 d.43.1.1 (E:140-282) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]}
dvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikpedvsaevvekeyqvqld
iamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvgqllkehnaevtgfirfe
vgegiekvetdfaaevaamskqs

SCOPe Domain Coordinates for d4q7je3:

Click to download the PDB-style file with coordinates for d4q7je3.
(The format of our PDB-style files is described here.)

Timeline for d4q7je3: