Lineage for d1g3ea_ (1g3e A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 230291Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 230292Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 230387Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins)
  6. 230904Protein Trypsin(ogen) [50515] (8 species)
  7. 230905Species Cow (Bos taurus) [TaxId:9913] [50516] (148 PDB entries)
  8. 230955Domain d1g3ea_: 1g3e A: [25922]
    complexed with 109, ca, cu, so4

Details for d1g3ea_

PDB Entry: 1g3e (more details), 1.8 Å

PDB Description: bovine beta-trypsin bound to para-amidino schiff-base copper (ii) chelate

SCOP Domain Sequences for d1g3ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3ea_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1g3ea_:

Click to download the PDB-style file with coordinates for d1g3ea_.
(The format of our PDB-style files is described here.)

Timeline for d1g3ea_: