Class a: All alpha proteins [46456] (289 folds) |
Fold a.53: p53 tetramerization domain [47718] (1 superfamily) core: 4 helices; bundle |
Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) homotetramer |
Family a.53.1.0: automated matches [259188] (1 protein) not a true family |
Protein automated matches [259190] (2 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [259192] (5 PDB entries) |
Domain d4cz7b1: 4cz7 B:302-331 [259195] Other proteins in same PDB: d4cz7b2, d4cz7c2, d4cz7d2, d4cz7e2, d4cz7f2 automated match to d3saka_ complexed with gol, po4 |
PDB Entry: 4cz7 (more details), 1.1 Å
SCOPe Domain Sequences for d4cz7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cz7b1 a.53.1.0 (B:302-331) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} eeiftlqvrgreryeilkklndslelsdvv
Timeline for d4cz7b1: