Lineage for d1c2ma_ (1c2m A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298675Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 298676Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 298774Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins)
  6. 299320Protein Trypsin(ogen) [50515] (8 species)
  7. 299321Species Cow (Bos taurus) [TaxId:9913] [50516] (160 PDB entries)
  8. 299346Domain d1c2ma_: 1c2m A: [25911]
    complexed with ca, mg, so4, zn

Details for d1c2ma_

PDB Entry: 1c2m (more details), 1.4 Å

PDB Description: recruiting zinc to mediate potent, specific inhibition of serine proteases

SCOP Domain Sequences for d1c2ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2ma_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1c2ma_:

Click to download the PDB-style file with coordinates for d1c2ma_.
(The format of our PDB-style files is described here.)

Timeline for d1c2ma_: