Lineage for d4pv1g_ (4pv1 G:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026327Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family) (S)
  5. 3026328Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (2 proteins)
  6. 3026339Protein automated matches [196847] (1 species)
    not a true protein
  7. 3026340Species Mastigocladus laminosus [TaxId:83541] [196848] (5 PDB entries)
  8. 3026341Domain d4pv1g_: 4pv1 G: [259095]
    Other proteins in same PDB: d4pv1a_, d4pv1b_, d4pv1d1, d4pv1d2, d4pv1e_, d4pv1f_, d4pv1h_
    automated match to d2e74g_
    complexed with 7ph, 8k6, bcr, cd, cla, fes, hec, mys, opc, sma, sqd, umq

Details for d4pv1g_

PDB Entry: 4pv1 (more details), 3 Å

PDB Description: cytochrome b6f structure from m. laminosus with the quinone analog inhibitor stigmatellin
PDB Compounds: (G:) Cytochrome b6-f complex subunit 5

SCOPe Domain Sequences for d4pv1g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pv1g_ f.23.26.1 (G:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
mveplldglvlglvfatlgglfyaayqqykrpnelgg

SCOPe Domain Coordinates for d4pv1g_:

Click to download the PDB-style file with coordinates for d4pv1g_.
(The format of our PDB-style files is described here.)

Timeline for d4pv1g_: