Lineage for d4qx2a3 (4qx2 A:500-644)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530952Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1530953Protein automated matches [190770] (24 species)
    not a true protein
  7. 1530967Species Bacillus thuringiensis [TaxId:1444] [258998] (3 PDB entries)
  8. 1530969Domain d4qx2a3: 4qx2 A:500-644 [258999]
    Other proteins in same PDB: d4qx2a1, d4qx2a2
    automated match to d1dlca1

Details for d4qx2a3

PDB Entry: 4qx2 (more details), 2.9 Å

PDB Description: cry3a toxin structure obtained by injecting bacillus thuringiensis cells in an xfel beam, collecting data by serial femtosecond crystallographic methods and processing data with the cctbx.xfel software suite
PDB Compounds: (A:) Pesticidal crystal protein cry3Aa

SCOPe Domain Sequences for d4qx2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qx2a3 b.18.1.0 (A:500-644) automated matches {Bacillus thuringiensis [TaxId: 1444]}
ffnmidskkitqlplvkayklqsgasvvagprftggdiiqctengsaatiyvtpdvsysq
kyrarihyastsqitftlsldgapfnqyyfdktinkgdtltynsfnlasfstpfelsgnn
lqigvtglsagdkvyidkiefipvn

SCOPe Domain Coordinates for d4qx2a3:

Click to download the PDB-style file with coordinates for d4qx2a3.
(The format of our PDB-style files is described here.)

Timeline for d4qx2a3: