![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins) |
![]() | Protein Trypsin(ogen) [50515] (8 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50516] (160 PDB entries) |
![]() | Domain d1c1ta_: 1c1t A: [25898] complexed with bab, ca, mg, so4 |
PDB Entry: 1c1t (more details), 1.37 Å
SCOP Domain Sequences for d1c1ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c1ta_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus)} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
Timeline for d1c1ta_: