SCOPe 2.08: Domain d4pjbe2: 4pjb E:111-198

Lineage for d4pjbe2 (4pjb E:111-198)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4pjbe2: 4pjb E:111-198 [258755]
   Other proteins in same PDB: d4pjba1, d4pjba2, d4pjba3, d4pjbb_, d4pjbc1, d4pjbc2, d4pjbc3, d4pjbd_, d4pjbe1, d4pjbf1, d4pjbg1, d4pjbh1
   automated match to d2f54d2
   complexed with 2lj, gol

Details for d4pjbe2

PDB Entry: 4pjb, 2.85 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait b-f3-c1 tcr

PDB Compounds: (E:) TCR-alpha

SCOPe Domain Sequences for d4pjbe2:

Sequence, based on SEQRES records:

>d4pjbe2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records):

>d4pjbe2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnd
facanafnnsiipedtffp

Timeline for d4pjbe2:

• d4pjbe2 first appeared in SCOPe 2.04
  
• d4pjbe2 appears in SCOPe 2.07