Lineage for d1gbt__ (1gbt -)
- Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins) Protein Trypsin(ogen) [50515] (8 species) 
Species Cow (Bos taurus) [TaxId:9913] [50516] (160 PDB entries) 
Domain d1gbt__: 1gbt - [25871]
complexed with ca, gbs, so4
Details for d1gbt__
PDB Entry: 1gbt (more details), 2 Å
PDB Description: structure of an acyl-enzyme intermediate during catalysis: (guanidinobenzoyl) trypsin
SCOP Domain Sequences for d1gbt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gbt__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
SCOP Domain Coordinates for d1gbt__:
Click to download the PDB-style file with coordinates for d1gbt__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gbt__:
- d1gbt__ first appeared (with stable ids) in SCOP 1.55
- d1gbt__ appears in SCOP 1.63
- d1gbt__ appears in SCOP 1.67
- d1gbt__ appears in the current release, SCOPe 2.08, called d1gbta_
View in 3D