SCOPe 2.07: Domain d4lyqa1: 4lyq A:1-413

Lineage for d4lyqa1 (4lyq A:1-413)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (125 species)
   not a true protein

7. Species Rhizomucor miehei [TaxId:4839] [256971] (7 PDB entries)

8. Domain d4lyqa1: 4lyq A:1-413 [258676]
   Other proteins in same PDB: d4lyqa2
   automated match to d1uuqa_
   complexed with epe, trs; mutant

Details for d4lyqa1

PDB Entry: 4lyq, 2 Å

PDB Description: crystal structure of glycoside hydrolase family 5 mannosidase from rhizomucor miehei, e202a mutant

PDB Compounds: (A:) Exo-beta-1,4-mannosidase

SCOPe Domain Sequences for d4lyqa1:

Sequence; same for both SEQRES and ATOM records:

>d4lyqa1 c.1.8.0 (A:1-413) automated matches {Rhizomucor miehei [TaxId: 4839]}
afvkiasdgkgftrygepylirganywqgmnlgaddcsggdrkrmeleikqmaemginnl
rvmassegpddqpyrmrpsmmpqpgkynegvfvgldylldtmdrynmtavmtlgnfwqws
ggfgqyvawitgnqtipypvgdvtydeftqfaarfyndseiapkanklfkdhiytvqnrr
ntvngkiykedpvimswqianapqeapaswfeeistfikkgapkhlvsagleskldeydf
drahdhknidyttchcwvenwgiydpadpdglphaneymhdflesrskwaaqlnkpivme
efgmardawrnpedetykylpstptshkdeyyqkafnqivslasnrsfsgsnfwayggeg
rstyppnpygmvwlgdpphephgwysvysndttvqiikdynanllkvqkelsk

Timeline for d4lyqa1:

• d4lyqa1 first appeared in SCOPe 2.04, called d4lyqa_
  
• d4lyqa1 was called d4lyqa_ in SCOPe 2.06
  
• d4lyqa1 appears in the current release, SCOPe 2.08