Lineage for d4lyra_ (4lyr A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570672Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1570673Protein automated matches [190075] (60 species)
    not a true protein
  7. 1570979Species Rhizomucor miehei [TaxId:4839] [256971] (6 PDB entries)
  8. 1570984Domain d4lyra_: 4lyr A: [258675]
    automated match to d1uuqa_
    complexed with epe, trs; mutant

Details for d4lyra_

PDB Entry: 4lyr (more details), 2.5 Å

PDB Description: Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei, E301A mutant
PDB Compounds: (A:) Exo-beta-1,4-mannosidase

SCOPe Domain Sequences for d4lyra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lyra_ c.1.8.0 (A:) automated matches {Rhizomucor miehei [TaxId: 4839]}
fafvkiasdgkgftrygepylirganywqgmnlgaddcsggdrkrmeleikqmaemginn
lrvmassegpddqpyrmrpsmmpqpgkynegvfvgldylldtmdrynmtavmtlgnfwqw
sggfgqyvawitgnqtipypvgdvtydeftqfaarfyndseiapkanklfkdhiytvqnr
rntvngkiykedpvimswqianepqeapaswfeeistfikkgapkhlvsagleskldeyd
fdrahdhknidyttchcwvenwgiydpadpdglphaneymhdflesrskwaaqlnkpivm
eafgmardawrnpedetykylpstptshkdeyyqkafnqivslasnrsfsgsnfwaygge
grstyppnpygmvwlgdpphephgwysvysndttvqiikdynanllkvqkelsk

SCOPe Domain Coordinates for d4lyra_:

Click to download the PDB-style file with coordinates for d4lyra_.
(The format of our PDB-style files is described here.)

Timeline for d4lyra_: