SCOPe 2.08: Domain d4cpeb_: 4cpe B:

Lineage for d4cpeb_ (4cpe B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d4cpeb_: 4cpe B: [258656]
   automated match to d1mk5a_
   complexed with luv

Details for d4cpeb_

PDB Entry: 4cpe, 1.06 Å

PDB Description: wild-type streptavidin in complex with love-hate ligand 1 (lh1)

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d4cpeb_:

Sequence; same for both SEQRES and ATOM records:

>d4cpeb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Timeline for d4cpeb_:

• d4cpeb_ first appeared in SCOPe 2.04
  
• d4cpeb_ appears in SCOPe 2.07