Lineage for d4cphb_ (4cph B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1552675Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1552676Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1552677Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1552986Protein automated matches [190191] (2 species)
    not a true protein
  7. 1553062Species Streptomyces avidinii [TaxId:1895] [189343] (30 PDB entries)
  8. 1553103Domain d4cphb_: 4cph B: [258652]
    automated match to d1n9mc_
    complexed with lh4

Details for d4cphb_

PDB Entry: 4cph (more details), 1.64 Å

PDB Description: trans-divalent streptavidin with love-hate ligand 4
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d4cphb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cphb_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp

SCOPe Domain Coordinates for d4cphb_:

Click to download the PDB-style file with coordinates for d4cphb_.
(The format of our PDB-style files is described here.)

Timeline for d4cphb_: