SCOP 1.65: Domain d1tgc__: 1tgc -

Lineage for d1tgc__ (1tgc -)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (160 PDB entries)

8. Domain d1tgc__: 1tgc - [25855]
   complexed with ca

Details for d1tgc__

PDB Entry: 1tgc, 1.8 Å

PDB Description: on the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography

SCOP Domain Sequences for d1tgc__:

Sequence; same for both SEQRES and ATOM records:

>d1tgc__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1tgc__:

• d1tgc__ first appeared (with stable ids) in SCOP 1.55
  
• d1tgc__ appears in SCOP 1.63
  
• d1tgc__ appears in SCOP 1.67
  
• d1tgc__ appears in the current release, SCOPe 2.08, called d1tgca_