SCOP 1.59: Domain d1tgsz_: 1tgs Z:

Lineage for d1tgsz_ (1tgs Z:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)

6. Protein Trypsin(ogen) [50515] (7 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (147 PDB entries)

8. Domain d1tgsz_: 1tgs Z: [25850]
   Other proteins in same PDB: d1tgsi_

Details for d1tgsz_

PDB Entry: 1tgs, 1.8 Å

PDB Description: three-dimensional structure of the complex between pancreatic secretory inhibitor (kazal type) and trypsinogen at 1.8 angstroms resolution. structure solution, crystallographic refinement and preliminary structural interpretation

SCOP Domain Sequences for d1tgsz_:

Sequence; same for both SEQRES and ATOM records:

>d1tgsz_ b.47.1.2 (Z:) Trypsin(ogen) {Cow (Bos taurus)}
dkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvv
egneqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqcli
sgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsg
gpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1tgsz_:

• d1tgsz_ first appeared (with stable ids) in SCOP 1.55
  
• d1tgsz_ appears in SCOP 1.57
  
• d1tgsz_ appears in SCOP 1.61
  
• d1tgsz_ appears in the current release, SCOPe 2.08