Lineage for d1qtfa_ (1qtf A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 376039Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 376040Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 376041Family b.47.1.1: Prokaryotic proteases [50495] (13 proteins)
  6. 376096Protein Exfoliative toxin B [50512] (1 species)
  7. 376097Species Staphylococcus aureus [TaxId:1280] [50513] (2 PDB entries)
  8. 376098Domain d1qtfa_: 1qtf A: [25830]

Details for d1qtfa_

PDB Entry: 1qtf (more details), 2.4 Å

PDB Description: crystal structure of exfoliative toxin b

SCOP Domain Sequences for d1qtfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus}
keysaeeirklkqkfevpptdkelythitdnarspynsvgtvfvkgstlatgvligknti
vtnyhvareaaknpsniiftpaqnrdaeknefptpygkfeaeeikespygqgldlaiikl
kpnekgesagdliqpanipdhidiakgdkysllgypynysayslyqsqiemfndsqyfgy
tevgnsgsgifnlkgeligihsgkggqhnlpigvffnrkisslysvdntfgdtlgndlkk
rakldk

SCOP Domain Coordinates for d1qtfa_:

Click to download the PDB-style file with coordinates for d1qtfa_.
(The format of our PDB-style files is described here.)

Timeline for d1qtfa_: