Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
Protein automated matches [226883] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225058] (4 PDB entries) |
Domain d4pkhe_: 4pkh E: [258215] Other proteins in same PDB: d4pkha1, d4pkha2, d4pkhd1, d4pkhd2, d4pkhf1, d4pkhf2, d4pkhi1, d4pkhi2 automated match to d1yagg_ complexed with adp, ca |
PDB Entry: 4pkh (more details), 2.15 Å
SCOPe Domain Sequences for d4pkhe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pkhe_ d.109.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydl hywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggv asgfg
Timeline for d4pkhe_: