Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d4pjhh2: 4pjh H:115-241 [258195] Other proteins in same PDB: d4pjha1, d4pjha2, d4pjhb1, d4pjhb2, d4pjhc1, d4pjhc2, d4pjhd1, d4pjhd2, d4pjhe1, d4pjhf1, d4pjhg1, d4pjhh1 automated match to d3of6b2 complexed with 30w, gol, na |
PDB Entry: 4pjh (more details), 2 Å
SCOPe Domain Sequences for d4pjhh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjhh2 b.1.1.2 (H:115-241) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeawgra
Timeline for d4pjhh2: