SCOPe 2.03: Domain d3sgae_: 3sga E:

Lineage for d3sgae_ (3sga E:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Protease A [50500] (1 species)

7. Species Streptomyces griseus, strain k1 [TaxId:1911] [50501] (5 PDB entries)

8. Domain d3sgae_: 3sga E: [25809]

Details for d3sgae_

PDB Entry: 3sga, 1.8 Å

PDB Description: structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis

PDB Compounds: (E:) proteinase a (sgpa)

SCOPe Domain Sequences for d3sgae_:

Sequence; same for both SEQRES and ATOM records:

>d3sgae_ b.47.1.1 (E:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]}
iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
l

Timeline for d3sgae_:

• d3sgae_ first appeared (with stable ids) in SCOP 1.55
  
• d3sgae_ appears in SCOPe 2.02
  
• d3sgae_ appears in SCOPe 2.04
  
• d3sgae_ appears in the current release, SCOPe 2.08