![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
![]() | Protein Retroviral integrase, catalytic domain [53108] (4 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries) |
![]() | Domain d4o55a_: 4o55 A: [258022] automated match to d1b9da_ complexed with lf9, so4 |
PDB Entry: 4o55 (more details), 2.24 Å
SCOPe Domain Sequences for d4o55a_:
Sequence, based on SEQRES records: (download)
>d4o55a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta vqmavfihnkkrkggiggysagerivdiiatdiq
>d4o55a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsttvkaacwwagikqefgesmnkelkkiigqvrdqaehlktavqmavfihnkk rkgggysagerivdiiatdiq
Timeline for d4o55a_: