Lineage for d1gbka_ (1gbk A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 167859Family b.47.1.1: Prokaryotic proteases [50495] (11 proteins)
  6. 167864Protein alpha-Lytic protease [50498] (1 species)
  7. 167865Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (38 PDB entries)
  8. 167886Domain d1gbka_: 1gbk A: [25790]

Details for d1gbka_

PDB Entry: 1gbk (more details), 2.13 Å

PDB Description: alpha-lytic protease with met 190 replaced by ala complex with methoxysuccinyl-ala-ala-pro-alanine boronic acid

SCOP Domain Sequences for d1gbka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gbka_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacagrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

SCOP Domain Coordinates for d1gbka_:

Click to download the PDB-style file with coordinates for d1gbka_.
(The format of our PDB-style files is described here.)

Timeline for d1gbka_: