SCOP 1.63: Domain d5lpra_: 5lpr A:

Lineage for d5lpra_ (5lpr A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (11 proteins)

6. Protein alpha-Lytic protease [50498] (1 species)

7. Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (38 PDB entries)

8. Domain d5lpra_: 5lpr A: [25789]
   complexed with b2a, msu, so4; mutant

Details for d5lpra_

PDB Entry: 5lpr, 2.13 Å

PDB Description: structural basis for broad specificity in alpha-lytic protease mutants

SCOP Domain Sequences for d5lpra_:

Sequence; same for both SEQRES and ATOM records:

>d5lpra_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

Timeline for d5lpra_:

• d5lpra_ first appeared (with stable ids) in SCOP 1.55
  
• d5lpra_ appears in SCOP 1.61
  
• d5lpra_ appears in SCOP 1.65
  
• d5lpra_ appears in the current release, SCOPe 2.08