SCOPe 2.07: Domain d4lhqc_: 4lhq C:

Lineage for d4lhqc_ (4lhq C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (9 species)
   not a true protein

7. Species Castor bean (Ricinus communis) [TaxId:3988] [188830] (15 PDB entries)

8. Domain d4lhqc_: 4lhq C: [257837]
   Other proteins in same PDB: d4lhqb_, d4lhqd_
   automated match to d1br5a_

Details for d4lhqc_

PDB Entry: 4lhq, 2.3 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh8)

PDB Compounds: (C:) ricin

SCOPe Domain Sequences for d4lhqc_:

Sequence; same for both SEQRES and ATOM records:

>d4lhqc_ d.165.1.1 (C:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
kqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvels
nhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggny
drleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqy
iegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvy
dvsilipiialmvyrcappp

Timeline for d4lhqc_:

• d4lhqc_ first appeared in SCOPe 2.04
  
• d4lhqc_ appears in SCOPe 2.06
  
• d4lhqc_ appears in the current release, SCOPe 2.08