Lineage for d4bwua_ (4bwu A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380194Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2380714Protein Pseudoazurin [49522] (4 species)
  7. 2380754Species Thiosphaera pantotropha [TaxId:82367] [49526] (5 PDB entries)
  8. 2380757Domain d4bwua_: 4bwu A: [257721]
    automated match to d3erxa_
    complexed with cu, so4; mutant

Details for d4bwua_

PDB Entry: 4bwu (more details), 1.76 Å

PDB Description: Three-dimensional structure of the K109A mutant of Paracoccus pantotrophus pseudoazurin at pH 5.5
PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d4bwua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bwua_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]}
athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpakarermdaela
qvn

SCOPe Domain Coordinates for d4bwua_:

Click to download the PDB-style file with coordinates for d4bwua_.
(The format of our PDB-style files is described here.)

Timeline for d4bwua_: