Lineage for d1tttc1 (1ttt C:213-312)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464636Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464647Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 464648Family b.43.3.1: Elongation factors [50448] (8 proteins)
  6. 464675Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 464691Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries)
  8. 464696Domain d1tttc1: 1ttt C:213-312 [25692]
    Other proteins in same PDB: d1ttta2, d1ttta3, d1tttb2, d1tttb3, d1tttc2, d1tttc3

Details for d1tttc1

PDB Entry: 1ttt (more details), 2.7 Å

PDB Description: phe-trna, elongation factor ef-tu:gdpnp ternary complex

SCOP Domain Sequences for d1tttc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tttc1 b.43.3.1 (C:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

SCOP Domain Coordinates for d1tttc1:

Click to download the PDB-style file with coordinates for d1tttc1.
(The format of our PDB-style files is described here.)

Timeline for d1tttc1: