Lineage for d1tttb3 (1ttt B:1-212)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484126Family c.37.1.8: G proteins [52592] (43 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 484287Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 484305Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries)
  8. 484309Domain d1tttb3: 1ttt B:1-212 [32126]
    Other proteins in same PDB: d1ttta1, d1ttta2, d1tttb1, d1tttb2, d1tttc1, d1tttc2

Details for d1tttb3

PDB Entry: 1ttt (more details), 2.7 Å

PDB Description: phe-trna, elongation factor ef-tu:gdpnp ternary complex

SCOP Domain Sequences for d1tttb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tttb3 c.37.1.8 (B:1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus}
akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
emhknpktkrgenewvdkiwelldaideyipt

SCOP Domain Coordinates for d1tttb3:

Click to download the PDB-style file with coordinates for d1tttb3.
(The format of our PDB-style files is described here.)

Timeline for d1tttb3: