Lineage for d1d8ta1 (1d8t A:205-296)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167557Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 167568Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 167569Family b.43.3.1: Elongation factors [50448] (5 proteins)
  6. 167586Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
  7. 167592Species Escherichia coli [TaxId:562] [50450] (4 PDB entries)
  8. 167595Domain d1d8ta1: 1d8t A:205-296 [25686]
    Other proteins in same PDB: d1d8ta2, d1d8ta3, d1d8tb2, d1d8tb3

Details for d1d8ta1

PDB Entry: 1d8t (more details), 2.35 Å

PDB Description: crystal structure of elongation factor, tu (ef-tu-mggdp) complexed with ge2270a, a thiazolyl peptide antibiotic

SCOP Domain Sequences for d1d8ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8ta1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOP Domain Coordinates for d1d8ta1:

Click to download the PDB-style file with coordinates for d1d8ta1.
(The format of our PDB-style files is described here.)

Timeline for d1d8ta1: