SCOPe 2.04: Domain d4kcea_: 4kce A:

Lineage for d4kcea_ (4kce A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (16 species)
   not a true protein

7. Species Leishmania braziliensis [TaxId:5660] [256848] (2 PDB entries)

8. Domain d4kcea_: 4kce A: [256851]
   automated match to d3qpmd_

Details for d4kcea_

PDB Entry: 4kce, 2.79 Å

PDB Description: Crystal structure of the mitochondrial peroxiredoxin from Leishmania braziliensis in the dimeric form

PDB Compounds: (A:) Peroxidoxin

SCOPe Domain Sequences for d4kcea_:

Sequence, based on SEQRES records:

>d4kcea_ c.47.1.10 (A:) automated matches {Leishmania braziliensis [TaxId: 5660]}
atvrdpapqfsgkavvdgaikeinsndykgkyivlffypmdftfvcpteiiafsdrylef
eklntqviavscdseyshlawvntprkkgglgemkipvladksmeiardygvliesagia
lrglfvidkkgtlrhstindlpvgrnvdevlrvveafqyadengdaipcgwt

Sequence, based on observed residues (ATOM records):

>d4kcea_ c.47.1.10 (A:) automated matches {Leishmania braziliensis [TaxId: 5660]}
atvrdpapqfsgkavvdgaikeinsndykgkyivlffypmvcpteiiafsdrylefekln
tqviavscdseyshlawvntprkkgglgemkipvladksmeiardygvliesagialrgl
fvidkkgtlrhstindlpvgrnvdevlrvveafqyadengdaipcgwt

Timeline for d4kcea_:

• d4kcea_ is new in SCOPe 2.04-stable
  
• d4kcea_ appears in SCOPe 2.05
  
• d4kcea_ appears in the current release, SCOPe 2.08