Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (16 species) not a true protein |
Species Leishmania braziliensis [TaxId:5660] [256848] (2 PDB entries) |
Domain d4kcea_: 4kce A: [256851] automated match to d3qpmd_ |
PDB Entry: 4kce (more details), 2.79 Å
SCOPe Domain Sequences for d4kcea_:
Sequence, based on SEQRES records: (download)
>d4kcea_ c.47.1.10 (A:) automated matches {Leishmania braziliensis [TaxId: 5660]} atvrdpapqfsgkavvdgaikeinsndykgkyivlffypmdftfvcpteiiafsdrylef eklntqviavscdseyshlawvntprkkgglgemkipvladksmeiardygvliesagia lrglfvidkkgtlrhstindlpvgrnvdevlrvveafqyadengdaipcgwt
>d4kcea_ c.47.1.10 (A:) automated matches {Leishmania braziliensis [TaxId: 5660]} atvrdpapqfsgkavvdgaikeinsndykgkyivlffypmvcpteiiafsdrylefekln tqviavscdseyshlawvntprkkgglgemkipvladksmeiardygvliesagialrgl fvidkkgtlrhstindlpvgrnvdevlrvveafqyadengdaipcgwt
Timeline for d4kcea_: