Lineage for d1dg1h1 (1dg1 H:205-296)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167557Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 167568Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 167569Family b.43.3.1: Elongation factors [50448] (5 proteins)
  6. 167586Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
  7. 167592Species Escherichia coli [TaxId:562] [50450] (4 PDB entries)
  8. 167598Domain d1dg1h1: 1dg1 H:205-296 [25685]
    Other proteins in same PDB: d1dg1g2, d1dg1g3, d1dg1h2, d1dg1h3

Details for d1dg1h1

PDB Entry: 1dg1 (more details), 2.5 Å

PDB Description: whole, unmodified, ef-tu(elongation factor tu).

SCOP Domain Sequences for d1dg1h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dg1h1 b.43.3.1 (H:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOP Domain Coordinates for d1dg1h1:

Click to download the PDB-style file with coordinates for d1dg1h1.
(The format of our PDB-style files is described here.)

Timeline for d1dg1h1: