Lineage for d4czfa2 (4czf A:150-345)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606151Species Caulobacter vibrioides [TaxId:155892] [256751] (4 PDB entries)
  8. 1606153Domain d4czfa2: 4czf A:150-345 [256755]
    automated match to d1jcfa2
    complexed with adp, mg

Details for d4czfa2

PDB Entry: 4czf (more details), 1.64 Å

PDB Description: C. crescentus MreB, single filament, ADP
PDB Compounds: (A:) rod shape-determining protein mreb

SCOPe Domain Sequences for d4czfa2:

Sequence, based on SEQRES records: (download)

>d4czfa2 c.55.1.0 (A:150-345) automated matches {Caulobacter vibrioides [TaxId: 155892]}
lpiheptgsmvvdigggttevavlslsgivysrsvrvggdkmdeaiisymrrhhnllige
ttaerikkeigtarapadgeglsidvkgrdlmqgvprevrisekqaadalaepvgqivea
vkvaleatppelasdiadkgimltgggallrgldaeirdhtglpvtvaddplscvalgcg
kvlehpkwmkgvlest

Sequence, based on observed residues (ATOM records): (download)

>d4czfa2 c.55.1.0 (A:150-345) automated matches {Caulobacter vibrioides [TaxId: 155892]}
lpiheptgsmvvdigggttevavlslsgivysrsvrvggdkmdeaiisymrrhhnllige
ttaerikkeigtarapglsidvkgrdlmqgvprevrisekqaadalaepvgqiveavkva
leatppelasdiadkgimltgggallrgldaeirdhtglpvtvaddplscvalgcgkvle
hpkwmkgvlest

SCOPe Domain Coordinates for d4czfa2:

Click to download the PDB-style file with coordinates for d4czfa2.
(The format of our PDB-style files is described here.)

Timeline for d4czfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4czfa1