SCOPe 2.04: Domain d4byaa_: 4bya A:

Lineage for d4byaa_ (4bya A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (20 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [187205] (2 PDB entries)

8. Domain d4byaa_: 4bya A: [256580]
   automated match to d1cmga_
   complexed with ca; mutant

Details for d4byaa_

PDB Entry: 4bya

PDB Description: calmodulin, c-terminal domain, m144h mutant

PDB Compounds: (A:) calmodulin, c-terminal domain, m144h mutant

SCOPe Domain Sequences for d4byaa_:

Sequence; same for both SEQRES and ATOM records:

>d4byaa_ a.39.1.5 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
slmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgd
gqvnyeefvqhmtak

Timeline for d4byaa_:

• d4byaa_ is new in SCOPe 2.04-stable
  
• d4byaa_ appears in SCOPe 2.05
  
• d4byaa_ appears in the current release, SCOPe 2.08, called d4byaa1