Class a: All alpha proteins [46456] (285 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (20 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [187205] (2 PDB entries) |
Domain d4byaa_: 4bya A: [256580] automated match to d1cmga_ complexed with ca; mutant |
PDB Entry: 4bya (more details)
SCOPe Domain Sequences for d4byaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4byaa_ a.39.1.5 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} slmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgd gqvnyeefvqhmtak
Timeline for d4byaa_: