Lineage for d1avac_ (1ava C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 60012Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 60013Family b.42.4.1: Kunitz (STI) inhibitors [50387] (5 proteins)
  6. 60014Protein Amylase/subtilisin inhibitor [50396] (2 species)
  7. 60015Species Barley (Hordeum vulgare), seed [TaxId:4513] [50397] (1 PDB entry)
  8. 60016Domain d1avac_: 1ava C: [25604]
    Other proteins in same PDB: d1avaa1, d1avaa2, d1avab1, d1avab2

Details for d1avac_

PDB Entry: 1ava (more details), 1.9 Å

PDB Description: amy2/basi protein-protein complex from barley seed

SCOP Domain Sequences for d1avac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avac_ b.42.4.1 (C:) Amylase/subtilisin inhibitor {Barley (Hordeum vulgare), seed}
adpppvhdtdghelradanyyvlsanrahgggltmapghgrhcplfvsqdpngqhdgfpv
ritpygvapsdkiirlstdvrisfrayttclqstewhidselaagrrhvitgpvkdpsps
grenafriekysgaevheyklmscgdwcqdlgvfrdlkggawflgatepyhvvvfkkapp
a

SCOP Domain Coordinates for d1avac_:

Click to download the PDB-style file with coordinates for d1avac_.
(The format of our PDB-style files is described here.)

Timeline for d1avac_: