Lineage for d1hwpb1 (1hwp B:2-135)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298063Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 298202Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 298203Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 298204Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 298223Species Sambucus ebulus, ebulin [TaxId:28503] [50376] (4 PDB entries)
  8. 298230Domain d1hwpb1: 1hwp B:2-135 [25575]
    Other proteins in same PDB: d1hwpa_

Details for d1hwpb1

PDB Entry: 1hwp (more details), 3.1 Å

PDB Description: ebulin complexed with pteroic acid, trigonal crystal form

SCOP Domain Sequences for d1hwpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwpb1 b.42.2.1 (B:2-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin}
getcaipapftrrivgrdglcvdvrngydtdgtpiqlwpcgtqrnqqwtfyndktirsmg
kcmtanglnsgsyimitdcstaaedatkwevlidgsiinpssglvmtapsgasrttllle
nnihaasqgwtvsn

SCOP Domain Coordinates for d1hwpb1:

Click to download the PDB-style file with coordinates for d1hwpb1.
(The format of our PDB-style files is described here.)

Timeline for d1hwpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hwpb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1hwpa_