![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
![]() | Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
![]() | Protein Plant cytotoxin B-chain (lectin) [50372] (5 species) duplication: consists of two domains of this fold |
![]() | Species Sambucus ebulus, ebulin [TaxId:28503] [50376] (4 PDB entries) |
![]() | Domain d1hwob1: 1hwo B:2-135 [25571] Other proteins in same PDB: d1hwoa_ complexed with bma, gal, glc, nag |
PDB Entry: 1hwo (more details), 2.9 Å
SCOPe Domain Sequences for d1hwob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwob1 b.42.2.1 (B:2-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} getcaipapftrrivgrdglcvdvrngydtdgtpiqlwpcgtqrnqqwtfyndktirsmg kcmtanglnsgsyimitdcstaaedatkwevlidgsiinpssglvmtapsgasrttllle nnihaasqgwtvsn
Timeline for d1hwob1: