SCOP 1.63: Domain d1abrb1: 1abr B:1-140

Lineage for d1abrb1 (1abr B:1-140)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.42: beta-Trefoil [50352] (6 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (2 families)

5. Family b.42.2.1: Ricin B-like [50371] (2 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (4 species)
   duplication: consists of two domains of this fold

7. Species Abrus precatorius [TaxId:3816] [50374] (1 PDB entry)

8. Domain d1abrb1: 1abr B:1-140 [25563]
   Other proteins in same PDB: d1abra_

Details for d1abrb1

PDB Entry: 1abr, 2.14 Å

PDB Description: crystal structure of abrin-a

SCOP Domain Sequences for d1abrb1:

Sequence; same for both SEQRES and ATOM records:

>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius}
ivekskicssryeptvriggrdgmcvdvydngyhngnriimwkckdrleenqlwtlksdk
tirsngkclttygyapgsyvmiydctsavaeatyweiwdngtiinpksalvlsaesssmg
gtltvqtneylmrqgwrtgn

Timeline for d1abrb1:

• d1abrb1 first appeared (with stable ids) in SCOP 1.55
  
• d1abrb1 appears in SCOP 1.61
  
• d1abrb1 appears in SCOP 1.65
  
• d1abrb1 appears in the current release, SCOPe 2.08