SCOPe 2.08: Domain d1irax_: 1ira X:

Lineage for d1irax_ (1ira X:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)

6. Protein Interleukin-1 receptor antagonist protein [50366] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50367] (5 PDB entries)

8. Domain d1irax_: 1ira X: [25556]
   Other proteins in same PDB: d1iray1, d1iray2, d1iray3
   complexed with nag

Details for d1irax_

PDB Entry: 1ira, 2.7 Å

PDB Description: complex of the interleukin-1 receptor with the interleukin-1 receptor antagonist (il1ra)

PDB Compounds: (X:) interleukin-1 receptor antagonist

SCOPe Domain Sequences for d1irax_:

Sequence; same for both SEQRES and ATOM records:

>d1irax_ b.42.1.2 (X:) Interleukin-1 receptor antagonist protein {Human (Homo sapiens) [TaxId: 9606]}
sskmqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflgihggkmc
lscvksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgwflctame
adqpvsltnmpdegvmvtkfyfqed

Timeline for d1irax_:

• d1irax_ first appeared (with stable ids) in SCOP 1.55
  
• d1irax_ appears in SCOPe 2.07