![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.1: Cytokine [50353] (3 families) ![]() |
![]() | Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins) |
![]() | Protein Interleukin-1beta [50363] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50364] (53 PDB entries) Uniprot P01584 117-269 |
![]() | Domain d1itba_: 1itb A: [25546] Other proteins in same PDB: d1itbb1, d1itbb2, d1itbb3 |
PDB Entry: 1itb (more details), 2.5 Å
SCOPe Domain Sequences for d1itba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1itba_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]} apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw yistsqaenmpvflggtkggqditdftmqfvss
Timeline for d1itba_: