Lineage for d1afcf_ (1afc F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401197Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2401198Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2401199Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 2401200Species Cow (Bos taurus) [TaxId:9913] [50358] (2 PDB entries)
  8. 2401208Domain d1afcf_: 1afc F: [25511]
    complexed with scr

Details for d1afcf_

PDB Entry: 1afc (more details), 2.7 Å

PDB Description: structural studies of the binding of the anti-ulcer drug sucrose octasulfate to acidic fibroblast growth factor
PDB Compounds: (F:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1afcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afcf_ b.42.1.1 (F:) Acidic FGF (FGF1) {Cow (Bos taurus) [TaxId: 9913]}
kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
ilflplp

SCOPe Domain Coordinates for d1afcf_:

Click to download the PDB-style file with coordinates for d1afcf_.
(The format of our PDB-style files is described here.)

Timeline for d1afcf_: