Lineage for d1ds8h1 (1ds8 H:36-256)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401018Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2401019Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2401020Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2401021Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2401022Species Rhodobacter sphaeroides [TaxId:1063] [50350] (87 PDB entries)
    Uniprot P11846
  8. 2401067Domain d1ds8h1: 1ds8 H:36-256 [25469]
    Other proteins in same PDB: d1ds8h2, d1ds8l_, d1ds8m_, d1ds8r_, d1ds8s_, d1ds8t2
    complexed with bcl, bph, cd, cl, fe2, lda, u10

Details for d1ds8h1

PDB Entry: 1ds8 (more details), 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor cd2+
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1ds8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds8h1 b.41.1.1 (H:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

SCOPe Domain Coordinates for d1ds8h1:

Click to download the PDB-style file with coordinates for d1ds8h1.
(The format of our PDB-style files is described here.)

Timeline for d1ds8h1: