Lineage for d1prch1 (1prc H:37-258)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401018Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2401019Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2401020Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2401021Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2401120Species Rhodopseudomonas viridis [TaxId:1079] [50349] (26 PDB entries)
  8. 2401134Domain d1prch1: 1prc H:37-258 [25460]
    Other proteins in same PDB: d1prcc_, d1prch2, d1prcl_, d1prcm_
    complexed with bcb, bpb, fe, hem, lda, mq7, ns1, so4, uq1

Details for d1prch1

PDB Entry: 1prc (more details), 2.3 Å

PDB Description: crystallographic refinement at 2.3 angstroms resolution and refined model of the photosynthetic reaction center from rhodopseudomonas viridis
PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d1prch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prch1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOPe Domain Coordinates for d1prch1:

Click to download the PDB-style file with coordinates for d1prch1.
(The format of our PDB-style files is described here.)

Timeline for d1prch1: