Lineage for d4no6h_ (4no6 H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600393Domain d4no6h_: 4no6 H: [253992]
    Other proteins in same PDB: d4no6a_, d4no6c_, d4no6e_, d4no6f_, d4no6i_, d4no6j_, d4no6k_, d4no6l_, d4no6n_, d4no6o_, d4no6q_, d4no6s_, d4no6t_, d4no6w_, d4no6x_, d4no6y_, d4no6z_
    automated match to d4eu2i_
    complexed with 2m1, mg

Details for d4no6h_

PDB Entry: 4no6 (more details), 3 Å

PDB Description: yCP in complex with Z-Leu-Leu-Leu-vinylsulfone
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4no6h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4no6h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d4no6h_:

Click to download the PDB-style file with coordinates for d4no6h_.
(The format of our PDB-style files is described here.)

Timeline for d4no6h_: