Lineage for d1a1da_ (1a1d A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 800248Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
  6. 800249Protein RNA polymerase subunit RBP8 [50322] (1 species)
  7. 800250Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (30 PDB entries)
    Uniprot P20436
  8. 800279Domain d1a1da_: 1a1d A: [25394]
    CA-atoms only

Details for d1a1da_

PDB Entry: 1a1d (more details)

PDB Description: yeast rna polymerase subunit rpb8, nmr, minimized average structure, alpha carbons only
PDB Compounds: (A:) RNA polymerase

SCOP Domain Sequences for d1a1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1da_ b.40.4.8 (A:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtia
sslnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfgg
llmrlegnyrnlnnlkqenayllirr

SCOP Domain Coordinates for d1a1da_:

Click to download the PDB-style file with coordinates for d1a1da_.
(The format of our PDB-style files is described here.)

Timeline for d1a1da_: